PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G52170.1
Common NameF17P19.7, HDG7, HDGL2-7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 682aa    MW: 75638.1 Da    PI: 6.0005
Description homeodomain GLABROUS 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G52170.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.6e-1959113256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k +++t++q++eLe++F+++++p++++r eL kkl L+ +q+k+WFqNrR+++k
  AT5G52170.1  59 TKYHRHTSYQIQELESFFKECPHPNEKQRLELGKKLTLESKQIKFWFQNRRTQMK 113
                  678899**********************************************999 PP

2START154.77.7e-492244262206
                  HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT......E CS
        START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg......g 89 
                  la ea++el+k+a++e  +W++ s    ++ ++  f          +r++g+v  ++  lve+l+d++ +W e+++     a+tlevis+g      g
  AT5G52170.1 224 LAMEAMDELLKLAELETSLWSSKS----EKGSMNHF--------PGSRETGLVLINSLALVETLMDTN-KWAEMFEcivaVASTLEVISNGsdgsrnG 308
                  57799***************9999....77788888........459*********************.***************************** PP

                  EEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHH CS
        START  90 alqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvk 186
                   + lm+ae+q++splvp +   f+Ry++q+g+g w++vdvS d ++ +++ +s+  ++++pSg++i++ +ng skvtw+eh ++++++ h+l+++l++
  AT5G52170.1 309 SILLMQAEFQVMSPLVPiKQKKFLRYCKQHGDGLWAVVDVSYDINRGNENLKSYGGSKMFPSGCIIQDIGNGCSKVTWIEHSEYEESHTHSLYQPLLS 406
                  ************************************************************************************************** PP

                  HHHHHHHHHHHHHTXXXXXX CS
        START 187 sglaegaktwvatlqrqcek 206
                  s++  ga +w+atlqrqce+
  AT5G52170.1 407 SSVGLGATKWLATLQRQCES 426
                  ******************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.25E-1838115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-2043115IPR009057Homeodomain-like
SMARTSM003895.2E-1453119IPR001356Homeobox domain
PROSITE profilePS5007116.97355115IPR001356Homeobox domain
PfamPF000461.1E-1659113IPR001356Homeobox domain
CDDcd000861.29E-1562115No hitNo description
PROSITE profilePS5084841.437214429IPR002913START domain
SuperFamilySSF559611.51E-30220427No hitNo description
CDDcd088752.81E-103220425No hitNo description
SMARTSM002348.8E-37223426IPR002913START domain
PfamPF018521.9E-42224426IPR002913START domain
SuperFamilySSF559612.47E-17450674No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000016anatomylateral root primordium
PO:0000017anatomyvascular leaf primordium
PO:0000026anatomyprimary root tip
PO:0005679anatomyepidermis
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0025257anatomyprimary root elongation zone
PO:0007131developmental stageseedling development stage
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MNGDLEVDMS RGDFNPSFFL GKLKDDEFES RSLSDDSFDA MSGDEDKQEQ RPKKKKRKTK  60
YHRHTSYQIQ ELESFFKECP HPNEKQRLEL GKKLTLESKQ IKFWFQNRRT QMKTQLERHE  120
NVILKQENEK LRLENSFLKE SMRGSLCIDC GGAVIPGEVS FEQHQLRIEN AKLKEELDRI  180
CALANRFIGG SISLEQPSNG GIGSQHLPIG HCVSGGTSLM FMDLAMEAMD ELLKLAELET  240
SLWSSKSEKG SMNHFPGSRE TGLVLINSLA LVETLMDTNK WAEMFECIVA VASTLEVISN  300
GSDGSRNGSI LLMQAEFQVM SPLVPIKQKK FLRYCKQHGD GLWAVVDVSY DINRGNENLK  360
SYGGSKMFPS GCIIQDIGNG CSKVTWIEHS EYEESHTHSL YQPLLSSSVG LGATKWLATL  420
QRQCESFTML LSSEDHTGLS HAGTKSILKL AQRMKLNFYS GITASCIHKW EKLLAENVGQ  480
DTRILTRKSL EPSGIVLSAA TSLWLPVTQQ RLFEFLCDGK CRNQWDILSN GASMENTLLV  540
PKGQQEGSCV SLLRAAGNDQ NESSMLILQE TWNDVSGALV VYAPVDIPSM NTVMSGGDSA  600
YVALLPSGFS ILPDGSSSSS DQFDTDGGLV NQESKGCLLT VGFQILVNSL PTAKLNVESV  660
ETVNNLIACT IHKIRAALRI PA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14957QRPKKKKRK
25257KKKKRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184233600.0
Genevisible248370_at0.0
Expression AtlasAT5G52170-
AtGenExpressAT5G52170-
ATTED-IIAT5G52170-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in cells around the base of leaf primordia, in the outermost 2 to 3 cell layers along the boundary between two leaf primordia. Expressed in lateral root primordia and tips, and in the epidermal boundaries of two cotyledons at heart-stage embryo. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family.
UniProtProbable transcription factor that binds to the DNA sequence 5'-GCATTAAATGC-3'. {ECO:0000269|PubMed:16778018}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00559DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G52170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G52170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256030.0AB025603.1 Arabidopsis thaliana genomic DNA, chromosome 5, BAC clone:F17P19.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200030.10.0homeobox-leucine zipper protein HDG7
SwissprotQ9LTK30.0HDG7_ARATH; Homeobox-leucine zipper protein HDG7
TrEMBLR0F0C90.0R0F0C9_9BRAS; Uncharacterized protein
STRINGAT5G52170.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Vandepoele K,Simillion C,Van de Peer Y
    Detecting the undetectable: uncovering duplicated segments in Arabidopsis by comparison with rice.
    Trends Genet., 2002. 18(12): p. 606-8
    [PMID:12446138]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  6. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  7. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  8. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  9. Zhao J, et al.
    Analysis of gene expression profiles in response to Sclerotinia sclerotiorum in Brassica napus.
    Planta, 2007. 227(1): p. 13-24
    [PMID:17665211]